быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRMT5 Rabbit mAb (A19533)
- Описание
- Характеристики
-
Overview
Product name PRMT5 Rabbit mAb Catalog No. A19533 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0011 Background
This gene encodes an enzyme that belongs to the methyltransferase family. The encoded protein catalyzes the transfer of methyl groups to the amino acid arginine, in target proteins that include histones, transcriptional elongation factors and the tumor suppressor p53. This gene plays a role in several cellular processes, including transcriptional regulation, and the assembly of small nuclear ribonucleoproteins. A pseudogene of this gene has been defined on chromosome 4. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT5 (O14744). Sequence MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIR Gene ID Swiss Prot Synonyms HSL7; JBP1; SKB1; IBP72; SKB1Hs; HRMT1L5 Calculated MW 73kDa Observed MW 73kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples A-431, HeLa, Hep G2, 293T, Mouse brain, Mouse spleen, Rat brain Cellular location Cytoplasm, Golgi apparatus, Nucleus 
Western blot analysis of extracts of various cell lines, using PRMT5 antibody (A19533) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat testis using PRMT5 antibody (A19533) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse testis using PRMT5 antibody (A19533) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRMT5 (O14744). Isotype IgG