быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Ferritin Heavy Chain Rabbit mAb (A19544)
- Описание
- Характеристики
-
Overview
Product name Ferritin Heavy Chain Rabbit mAb Catalog No. A19544 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0023 Background
This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794). Sequence MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNA Gene ID Swiss Prot Synonyms FHC; FTH; HFE5; PLIF; FTHL6; PIG15 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-251 MG, Mouse brain, Mouse heart, Rat brain, Rat liver Cellular location cytoplasm, cytosol, extracellular exosome, extracellular region, nucleus Customer validation WB(Mus musculus, Rattus norvegicus, Gallus gallus, Homo sapiens, Pullus, Sus scrofa)
WB、IF(Mus musculus)
qRT-PCR(Homo sapiens)
IF(Cyprinus carpio)
RT-qPCR(Homo sapiens)
WB(Homo sapiens)
WB，IHC(Homo sapiens)
IF(Homo sapiens,Mus musculus)
IHC(Homo sapiens,Mus musculus)
Western blot analysis of extracts of U-251MG cells, using Ferritin Heavy Chain antibody (A19544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of various cell lines, using Ferritin Heavy Chain antibody (A19544) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794). Isotype IgG