быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PKR/EIF2AK2 Rabbit mAb (A19545)
- Описание
- Характеристики
-
Overview
Product name PKR/EIF2AK2 Rabbit mAb Catalog No. A19545 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0024 Background
The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. The encoded protein plays an important role in the innate immune response against multiple DNA and RNA viruses.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human PKR/EIF2AK2 (P19525). Sequence GTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC Gene ID Swiss Prot Synonyms PKR; PRKR; DYT33; LEUDEN; EIF2AK1; PPP1R83 Calculated MW 62kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, MCF7, SH-SY5Y, HepG2 Cellular location Cytoplasm, Nucleus, perinuclear region Customer validation RIP(Mus musculus)
WB(Danio rerio)
Western blot analysis of extracts of various cell lines, using PKR/EIF2AK2 antibody (A19545) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human PKR/EIF2AK2 (P19525). Isotype IgG