быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-8 Rabbit mAb (A19549)
- Описание
- Характеристики
-
Overview
Product name Caspase-8 Rabbit mAb Catalog No. A19549 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0028 Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-8 (Q14790). Sequence EELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ Gene ID Swiss Prot Synonyms CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8 Calculated MW 55kDa Observed MW 57kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, HepG2 Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens,Mus musculus)

Western blot analysis of extracts of various cell lines, using Caspase-8 antibody (A19549) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-8 (Q14790). Isotype IgG







