быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-6 Rabbit mAb (A19559)
- Описание
- Характеристики
-
Overview
Product name Caspase-6 Rabbit mAb Catalog No. A19559 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0038 Background
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-6 (P55212). Sequence IHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTL Gene ID Swiss Prot Synonyms MCH2; CSP-6; caspase-6 Calculated MW 33kDa Observed MW 34kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples MCF7, Mouse testis Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using Caspase-6 antibody (A19559) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of NIH-3T3 cells using Caspase-6 antibody (A19559). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Caspase-6 (P55212). Isotype IgG







