быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tau Rabbit mAb (A19560)
- Описание
- Характеристики
-
Overview
Product name Tau Rabbit mAb Catalog No. A19560 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0039 Background
This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Tau (NP_058519.3). Sequence PKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPG Gene ID Swiss Prot Synonyms TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6 Calculated MW 79kDa Observed MW 55-90kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SH-SY5Y, U-251MG Cellular location Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, axon, cytoskeleton, cytosol Customer validation WB(Mus musculus)
IHC(Canis lupus familiaris)
Western blot analysis of extracts of various cell lines, using Tau antibody (A19560) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 550-650 of human Tau (NP_058519.3). Isotype IgG