быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
STAT1 Rabbit mAb (A19563)
- Описание
- Характеристики
-
Overview
Product name STAT1 Rabbit mAb Catalog No. A19563 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0042 Background
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224). Sequence MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQ Gene ID Swiss Prot Synonyms CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91 Calculated MW 87kDa Observed MW 87kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HepG2, HeLa, Mouse thymus, Rat liver Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens, Gallus gallus, Mus musculus)
Western blot analysis of extracts of various cell lines, using STAT1 antibody (A19563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 600 μg extracts of HeLa cells using 3 μg STAT1 antibody (A19563). Western blot was performed from the immunoprecipitate using STAT1 antibody (A19563) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224). Isotype IgG