быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KAP1/TRIM28 Rabbit mAb (A19568)
- Описание
- Характеристики
-
Overview
Product name KAP1/TRIM28 Rabbit mAb Catalog No. A19568 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0047 Background
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human KAP1/TRIM28 (Q13263). Sequence RNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS Gene ID Swiss Prot Synonyms KAP1; TF1B; RNF96; TIF1B; PPP1R157; TIF1beta Calculated MW 89kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, Jurkat, A-431, Mouse brain, Mouse testis Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using KAP1/TRIM28 antibody (A19568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using KAP1/TRIM28 antibody (A19568) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human kidney using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human spleen using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse intestin using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse kidney using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse spleen using KAP1/TRIM28 Rabbit mAb (A19568) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg KAP1/TRIM28 antibody (A19568). Western blot was performed from the immunoprecipitate using KAP1/TRIM28 antibody (A19568) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human KAP1/TRIM28 (Q13263). Isotype IgG