быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EZH2/KMT6 Rabbit mAb (A19577)
- Описание
- Характеристики
-
Overview
Product name EZH2/KMT6 Rabbit mAb Catalog No. A19577 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0056 Background
This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 148-272 of human EZH2/KMT6 (Q15910). Sequence ELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSV Gene ID Swiss Prot Synonyms WVS; ENX1; KMT6; WVS2; ENX-1; EZH2b; KMT6A Calculated MW 85kDa Observed MW 98kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Jurkat, HeLa Cellular location Nucleus Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using EZH2/KMT6 antibody (A19577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using EZH2/KMT6 antibody (A19577) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 148-272 of human EZH2/KMT6 (Q15910). Isotype IgG