быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
COPS3 Rabbit mAb (A19584)
- Описание
- Характеристики
-
Overview
Product name COPS3 Rabbit mAb Catalog No. A19584 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2182 Background
The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-423 of human COPS3 (Q9UNS2). Sequence QDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS Gene ID Swiss Prot Synonyms CSN3; SGN3 Calculated MW 48kDa Observed MW 44kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples A-549, RD, Mouse testis, Mouse brain, Mouse kidney, Rat brain, Rat spleen Cellular location Cytoplasm, Cytosol, Nucleoplasm, Nucleus, Perinuclear region of cytoplasm 
Western blot analysis of extracts of various cell lines, using COPS3 Rabbit mAb (A19584) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon using COPS3 Rabbit mAb (A19584) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using COPS3 Rabbit mAb (A19584) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat heart using COPS3 Rabbit mAb (A19584) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 320-423 of human COPS3 (Q9UNS2). Isotype IgG