быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CTCF Rabbit mAb (A19588)
- Описание
- Характеристики
-
Overview
Product name CTCF Rabbit mAb Catalog No. A19588 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0067 Background
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). Sequence PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR Gene ID Swiss Prot Synonyms MRD21; FAP108; CFAP108 Calculated MW 83kDa Observed MW 140kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP ChIP ChIP-seq CUT&Tag Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
- ChIP 1:20 - 1:100
- CUT&Tag 10⁵ cells /2 μg
- ChIP-seq 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples Jurkat, HeLa, Mouse lung, 293T Cellular location Chromosome, Nucleus, centromere, nucleoplasm 
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K562 cells with 2 ug CTCF Rabbit mAb，along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of CTCF in representative gene loci (MYC), as shown in figure.
Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and CTCF Rabbit mAb (A19588). The ChIP sequencing results indicate the enrichment pattern of CTCF in selected genomic region and representative gene loci (MYC), as shown in figure.
Western blot analysis of extracts of various cell lines, using CTCF antibody (A19588) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of C6 cells using CTCF Rabbit mAb (A19588) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using CTCF Rabbit mAb (A19588) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg CTCF antibody (A19588). Western blot was performed from the immunoprecipitate using CTCF antibody (A19588) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (A19588) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). Isotype IgG