быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LHX3 Rabbit mAb (A19590)
- Описание
- Характеристики
-
Overview
Product name LHX3 Rabbit mAb Catalog No. A19590 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2150 Background
This gene encodes a member of a large family of proteins which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene cause combined pituitary hormone deficiency 3. Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX3 (Q9UBR4). Sequence DSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSG Gene ID Swiss Prot Synonyms LIM3; CPHD3; M2-LHX3 Calculated MW 43kDa Observed MW 43kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, C6, SH-SY5Y, Mouse brain, Mouse kidney, Mouse uterus, Rat brain Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using LHX3 Rabbit mAb (A19590) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human LHX3 (Q9UBR4). Isotype IgG