быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SMC3 Rabbit mAb (A19591)
- Описание
- Характеристики
-
Overview
Product name SMC3 Rabbit mAb Catalog No. A19591 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2186 Background
This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1). Sequence GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG Gene ID Swiss Prot Synonyms BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1 Calculated MW 142kDa Observed MW 142kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples HeLa, NIH/3T3, Jurkat, C6, U-87MG, Mouse brain, Mouse spleen Cellular location Nucleus, Chromosome, Chromosome, centromere 
Western blot analysis of extracts of various cell lines, using SMC3 Rabbit mAb (A19591) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of U2OS using SMC3 antibody (A19591) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 using SMC3 antibody (A19591) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C6 using SMC3 antibody (A19591) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of U-87MG cells using 3 μg SMC3 antibody (A19591). Western blot was performed from the immunoprecipitate using SMC3 antibody (A19591) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1). Isotype IgG