быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BNIP3 Rabbit mAb (A19593)
- Описание
- Характеристики
-
Overview
Product name BNIP3 Rabbit mAb Catalog No. A19593 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC50531 Background
This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3). Sequence AFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG Gene ID Swiss Prot Synonyms NIP3; HABON Calculated MW 22kDa Observed MW 22-28kDa/50-55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Hela+Cobalt chloride, NIH/3T3+Cobalt chloride Cellular location Mitochondrion, Mitochondrion outer membrane, Single-pass membrane protein Customer validation WB(Mus musculus)
IHC(Canis lupus familiaris)
WB(Canis lupus familiaris)
Western blot analysis of extracts of various cell lines, using BNIP3 antibody (A19593) at 1:1000 dilution.Hela cells and NIH/3T3 cells were treated by Cobalt chloride (0.1 mM) at 37℃ for 4 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human liver using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat heart using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using BNIP3 Rabbit mAb (A19593) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human BNIP3 (NP_004043.3). Isotype IgG