быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NFAT2 Rabbit mAb (A19597)
- Описание
- Характеристики
-
Overview
Product name NFAT2 Rabbit mAb Catalog No. A19597 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0076 Background
The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 844-943 of human NFAT2 (O95644). Sequence PSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHEDGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS Gene ID Swiss Prot Synonyms NFAT2; NFATc; NF-ATC; NF-ATc1.2 Calculated MW 101kDa Observed MW 110kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, K-562, Jurkat, 293T Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus)

Western blot analysis of extracts of various cell lines, using NFAT2 antibody (A19597) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 844-943 of human NFAT2 (O95644). Isotype IgG







