быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ETS1 Rabbit mAb (A19603)
- Описание
- Характеристики
-
Overview
Product name ETS1 Rabbit mAb Catalog No. A19603 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0082 Background
This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921). Sequence MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM Gene ID Swiss Prot Synonyms p54; ETS-1; EWSR2; c-ets-1 Calculated MW 50kDa Observed MW 46kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, Jurkat, Raji, MCF7 Cellular location Cytoplasm, Nucleus Customer validation ChIP(Mus musculus)
Western blot analysis of extracts of various cell lines, using ETS1 antibody (A19603) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921). Isotype IgG