быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NF-κB2 Rabbit mAb (A19605)
- Описание
- Характеристики
-
Overview
Product name NF-κB2 Rabbit mAb Catalog No. A19605 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0084 Background
This gene encodes a subunit of the transcription factor complex nuclear factor-kappa-B (NFkB). The NFkB complex is expressed in numerous cell types and functions as a central activator of genes involved in inflammation and immune function. The protein encoded by this gene can function as both a transcriptional activator or repressor depending on its dimerization partner. The p100 full-length protein is co-translationally processed into a p52 active form. Chromosomal rearrangements and translocations of this locus have been observed in B cell lymphomas, some of which may result in the formation of fusion proteins. There is a pseudogene for this gene on chromosome 18. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 745-877 of human NF-κB2 (Q00653). Sequence LLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEA Gene ID Swiss Prot Synonyms p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100 Calculated MW 97kDa Observed MW 120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples THP-1, MCF7, HeLa, NIH/3T3, C6, Mouse thymus Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using NF-κB2 antibody (A19605) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded human appendix using NF-κB2 antibody (A19605) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 745-877 of human NF-κB2 (Q00653). Isotype IgG