быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PAK1 Rabbit mAb (A19608)
- Описание
- Характеристики
-
Overview
Product name PAK1 Rabbit mAb Catalog No. A19608 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0087 Background
This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Mutations in this gene have been associated with macrocephaly, seizures, and speech delay. Overexpression of this gene is also reported in many cancer types, and particularly in breast cancer. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK1 (Q13153). Sequence MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMP Gene ID Swiss Prot Synonyms IDDMSSD; p65-PAK; PAKalpha; alpha-PAK Calculated MW 61kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Jurkat, Mouse testis, Rat brain, C6 Cellular location Cell junction, Cell membrane, Cell projection, Cytoplasm, focal adhesion, invadopodium, ruffle membrane Customer validation WB(Mus musculus, Mus musculus、Sus scrofa)
ICC(Mus musculus)
Western blot analysis of extracts of various cell lines, using PAK1 antibody (A19608) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH-3T3 cells using PAK1 antibody (A19608). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAK1 (Q13153). Isotype IgG