быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Secretagogin (SCGN) Rabbit mAb (A19615)
- Описание
- Характеристики
-
Overview
Product name Secretagogin (SCGN) Rabbit mAb Catalog No. A19615 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2196 Background
The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038). Sequence ILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP Gene ID Swiss Prot Synonyms SEGN; CALBL; SECRET; setagin; DJ501N12.8 Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brain, Rat pancreas Cellular location Cytoplasm, Secreted, Cytoplasmic vesicle, secretory vesicle membrane, Nucleus, Cytosol 
Western blot analysis of extracts of various cell lines, using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse stomach using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat pancreatic islet using Secretagogin (Secretagogin (SCGN)) Rabbit mAb (A19615) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 177-276 of human Secretagogin (Secretagogin (SCGN)) (O76038). Isotype IgG