быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
RAB9P40 Rabbit mAb (A19616)
- Описание
- Характеристики
-
Overview
Product name RAB9P40 Rabbit mAb Catalog No. A19616 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2194 Background
Predicted to be involved in receptor-mediated endocytosis and vesicle docking involved in exocytosis. Predicted to be located in cytoplasmic vesicle; cytosol; and trans-Golgi network membrane.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1). Sequence YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD Gene ID Swiss Prot Synonyms p40; RAB9P40; bA65N13.1 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, Mouse testis, Mouse brain, Rat testis Cellular location Cytosol, Endosome, Transport vesicle 
Western blot analysis of extracts of various cell lines, using RAB9RAB9P40 Rabbit mAb (A19616) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1). Isotype IgG