быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cullin 3 Rabbit mAb (A19623)
- Описание
- Характеристики
-
Overview
Product name Cullin 3 Rabbit mAb Catalog No. A19623 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0102 Background
This gene encodes a member of the cullin protein family. The encoded protein plays a critical role in the polyubiquitination and subsequent degradation of specific protein substrates as the core component and scaffold protein of an E3 ubiquitin ligase complex. Complexes including the encoded protein may also play a role in late endosome maturation. Mutations in this gene are a cause of type 2E pseudohypoaldosteronism. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 669-768 of human Cullin 3 (Q13618). Sequence LHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA Gene ID Swiss Prot Synonyms CUL-3; PHA2E; NEDAUS Calculated MW 89kDa Observed MW 89kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, Mouse brain, Mouse testis, Rat brain Cellular location Golgi apparatus, Nucleus 
Western blot analysis of extracts of various cell lines, using Cullin 3 antibody (A19623) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using Cullin 3 antibody (A19623) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human oophoroma using Cullin 3 antibody (A19623) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using Cullin 3 antibody (A19623) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 669-768 of human Cullin 3 (Q13618). Isotype IgG