быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CRM1/XPO1 Rabbit mAb (A19625)
- Описание
- Характеристики
-
Overview
Product name CRM1/XPO1 Rabbit mAb Catalog No. A19625 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0104 Background
This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 972-1071 of human CRM1/XPO1 (O14980). Sequence IFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD Gene ID Swiss Prot Synonyms emb; CRM1; exp1; CRM-1; Exportin 1; Calculated MW 123kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples U2OS, MCF7, HeLa, Mouse thymus, Mouse lung Cellular location Cajal body, Cytoplasm, Nucleus, nucleolus, nucleoplasm Customer validation (MOLT-4、MCF-7)
Co-IP(Homo sapiens)
Western blot analysis of extracts of mouse lung, using CRM1/XPO1 antibody (A19625) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of various cell lines, using CRM1/XPO1 antibody (A19625) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded rat spleen using CRM1/XPO1 antibody (A19625) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using CRM1/XPO1 antibody (A19625) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using CRM1/XPO1 antibody (A19625) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using CRM1/XPO1 antibody (A19625). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using CRM1/XPO1 antibody (A19625). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using CRM1/XPO1 antibody (A19625). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 972-1071 of human CRM1/XPO1 (O14980). Isotype IgG