быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HDAC2 Rabbit mAb (A19626)
- Описание
- Характеристики
-
Overview
Product name HDAC2 Rabbit mAb Catalog No. A19626 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2647 Background
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3). Sequence MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED Gene ID Swiss Prot Synonyms HD2; RPD3; YAF1; KDAC2 Calculated MW 55kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, 293T, NIH/3T3, C6, Mouse liver Cellular location Cytoplasm, Nucleus Customer validation (HT29、SNB-19、A549、PC-3、Ramos、U87-MG)
WB(Rattus norvegicus, Mus musculus)
Western blot analysis of extracts of various cell lines, using HDAC2 antibody (A19626) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HDAC2 antibody (A19626). Western blot was performed from the immunoprecipitate using HDAC2 antibody (A19626) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3). Isotype IgG