быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENTPD5 Rabbit mAb (A19642)
- Описание
- Характеристики
-
Overview
Product name ENTPD5 Rabbit mAb Catalog No. A19642 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2210 Background
The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human ENTPD5 (O75356). Sequence FEPCYAEVLRVVRGKLHQPEEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ Gene ID Swiss Prot Synonyms PCPH; CD39L4; NTPDase-5 Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse liver, Rat liver, Rat kidney Cellular location endoplasmic reticulum, extracellular region, extracellular space 
Western blot analysis of various lysates, using ENTPD5 Rabbit mAb (A19642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of 293T, using ENTPD5 Rabbit mAb (A19642) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human ENTPD5 (O75356). Isotype IgG