быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cadherin 16 Rabbit mAb (A19644)
- Описание
- Характеристики
-
Overview
Product name Cadherin 16 Rabbit mAb Catalog No. A19644 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2212 Background
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CDH3, CDH5, CDH8 and CDH11. The protein consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development. Alternatively spliced transcript variants encoding distinct isoforms have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309). Sequence GAEGQIVLSGDSGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMF Gene ID Swiss Prot Synonyms Ksp cadherin Calculated MW 90kDa Observed MW 120kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse kidney Cellular location Basolateral plasma membrane, extracellular exosome, Plasma membrane 
Western blot analysis of extracts of Mouse kidney, using Cadherin 16 Rabbit mAb (A19644) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of mouse kidney cells using Cadherin 16 Rabbit mAb (A19644) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309). Isotype IgG