быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PML Rabbit mAb (A19646)
- Описание
- Характеристики
-
Overview
Product name PML Rabbit mAb Catalog No. A19646 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0125 Background
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PML (P29590). Sequence MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGAD Gene ID Swiss Prot Synonyms MYL; RNF71; PP8675; TRIM19 Calculated MW 98kDa Observed MW 68-120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, 293T Cellular location Cytoplasm, Cytoplasmic side, Early endosome membrane, Endoplasmic reticulum membrane, Nucleus, PML body, Peripheral membrane protein, nucleolus, nucleoplasm 
Western blot analysis of extracts of various cell lines, using PML antibody (A19646) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PML (P29590). Isotype IgG







