быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENTPD5 Rabbit mAb (A19647)
- Описание
- Характеристики
-
Overview
Product name ENTPD5 Rabbit mAb Catalog No. A19647 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2211 Background
The protein encoded by this gene is similar to E-type nucleotidases (NTPases)/ecto-ATPase/apyrases. NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD5 contains 4 apyrase-conserved regions which is characteristic of NTPases.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human ENTPD5 (O75356). Sequence GAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTLDL Gene ID Swiss Prot Synonyms PCPH; CD39L4; NTPDase-5 Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:3000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, PC-3, Mouse liver, Rat liver, Rat kidney Cellular location endoplasmic reticulum, extracellular region, extracellular space 
Western blot analysis of extracts of various cell lines, using ENTPD5 Rabbit mAb (A19647) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using ENTPD5 Rabbit mAb (A19647) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human colon using ENTPD5 Rabbit mAb (A19647) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using ENTPD5 Rabbit mAb (A19647) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using ENTPD5 Rabbit mAb (A19647) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human ENTPD5 (O75356). Isotype IgG