быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NF-kB p65/RelA Rabbit mAb (A19653)
- Описание
- Характеристики
-
Overview
Product name NF-kB p65/RelA Rabbit mAb Catalog No. A19653 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51086 Background
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-κB p65 (Q04206). Sequence LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS Gene ID Swiss Prot Synonyms p65; CMCU; NFKB3; AIF3BL3 Calculated MW 60kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat, Monkey Tested applications WB IHC-P IF/ICC IP ChIP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples PC-12, Mouse spleen, Mouse lung Cellular location Cytoplasm, Nucleus Customer validation (RPMI-8226、PC-3、HepG2、Hela、U2-OS、Jurkat、MOLT-4)
WB(Mus musculus, Homo sapiens, Rattus norvegicus)
IF(Homo sapiens)
IHC(Rattus norvegicus, A. baumannii)
WB(Homo sapiens)
IF(Rattus norvegicus, Mus musculus , Mus musculus)
WB，IF(Rattus norvegicus, Mus musculus)
IP(Mus musculus )
(Rattus norvegicus)
IHC(Mus musculus)
IF/ICC(Homo sapiens)
FC(Homo sapiens )
Western blot analysis of extracts of various lysates, using NF-kB p65/RelA Rabbit mAb (A19653) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human colon using NF-kB p65/RelA antibody (A19653) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using NF-kB p65/RelA antibody (A19653) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using NF-kB p65/RelA Rabbit mAb (A19653) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Chromatin immunoprecipitation analysis of extracts of HT-1080 treated by TNF-α (20 ng/ml) at 37℃ for 30 minutes, using NF-kB p65/RelA Rabbit mAb antibody (A19653) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Обезьяна Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-κB p65 (Q04206). Isotype IgG