быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Fibrinogen alpha chain (FGA) Rabbit mAb (A19658)
- Описание
- Характеристики
-
Overview
Product name Fibrinogen alpha chain (FGA) Rabbit mAb Catalog No. A19658 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2227 Background
This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that undergoes proteolytic processing.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671). Sequence NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA Gene ID Swiss Prot Synonyms Fib2 Calculated MW 95kDa Observed MW 95kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Rat liver Cellular location blood microparticle, cell surface, endoplasmic reticulum, endoplasmic reticulum lumen, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, fibrinogen complex, plasma membrane 
Western blot analysis of extracts of various cell lines, using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse lung using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using Fibrinogen alpha chain (FGA) (FGA) Rabbit mAb (A19658) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinogen alpha chain (FGA) (FGA) (P02671). Isotype IgG