быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CTRL Rabbit mAb (A19660)
- Описание
- Характеристики
-
Overview
Product name CTRL Rabbit mAb Catalog No. A19660 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2218 Background
This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 165-264 of human CTRL (P40313). Sequence GVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Gene ID Swiss Prot Synonyms CTRL1 Calculated MW 28kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:5000 - 1:8000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse pancreas, Rat pancreas Cellular location extracellular space 
Western blot analysis of extracts of various cell lines, using CTRL Rabbit mAb (A19660) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse pancreas using CTRL Rabbit mAb (A19660) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat pancreas using CTRL Rabbit mAb (A19660) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat pancreas cells using CTRL Rabbit mAb (A19660) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse pancreas cells using CTRL Rabbit mAb (A19660) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 165-264 of human CTRL (P40313). Isotype IgG