быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Daxx Rabbit mAb (A19661)
- Описание
- Характеристики
-
Overview
Product name Daxx Rabbit mAb Catalog No. A19661 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2220 Background
This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Daxx (Q9UER7). Sequence AEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARH Gene ID Swiss Prot Synonyms DAP6; EAP1; BING2; SMIM40 Calculated MW 81kDa Observed MW 110kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, SH-SY5Y Cellular location cytosol, nuclear body, nucleolus, nucleoplasm, nucleus, PML body 
Western blot analysis of extracts of various cell lines, using Daxx Rabbit mAb (A19661) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Daxx (Q9UER7). Isotype IgG







