быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Caspase-3 p12 Rabbit mAb (A19664)
- Описание
- Характеристики
-
Overview
Product name Caspase-3 p12 Rabbit mAb Catalog No. A19664 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0143 Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 176-277 of human Caspase-3 p12 (P42574). Sequence SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH Gene ID Swiss Prot Synonyms CPP32; SCA-1; CPP32B Calculated MW 32kDa Observed MW 12kDa/30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse liver, NIH/3T3, Rat spleen, Rat liver Cellular location Cytoplasm Customer validation WB(Rattus norvegicus, Homo sapiens, Cyprinus carpio)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using Caspase-3 p12 antibody (A19664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded rat spleen using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using Caspase-3 p12 antibody (A19664) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using Caspase-3 p12 antibody (A19664).HeLa cells were treated by Etoposide (25 uM) at 37℃ for 5 hours. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 176-277 of human Caspase-3 p12 (P42574). Isotype IgG