быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PPARγ Rabbit mAb (A19676)
- Описание
- Характеристики
-
Overview
Product name PPARγ Rabbit mAb Catalog No. A19676 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0155 Background
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARγ (P37231). Sequence LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH Gene ID Swiss Prot Synonyms GLM1; CIMT1; NR1C3; PPARG1; PPARG2; PPARG5; PPARgamma Calculated MW 58kDa Observed MW 70kDa Applications
Reactivity Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat liver, Rat heart Cellular location Cytoplasm, Nucleus Customer validation WB(Mus musculus, Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using PPARγ antibody (A19676) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARγ (P37231). Isotype IgG