быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Mitofusin 2 Rabbit mAb (A19678)
- Описание
- Характеристики
-
Overview
Product name Mitofusin 2 Rabbit mAb Catalog No. A19678 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0157 Background
This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140). Sequence MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDTYRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVA Gene ID Swiss Prot Synonyms HSG; MARF; CMT2A; CPRP1; CMT2A2; HMSN6A; CMT2A2A; CMT2A2B Calculated MW 86kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Raji, MCF7, 293T, NIH/3T3, Mouse brain, Rat heart, Rat brain Cellular location Mitochondrion outer membrane, Multi-pass membrane protein Customer validation WB(Rattus norvegicus, Mus musculus, Homo sapiens, Sus scrofa)
IHC(Mus musculus,Rattus norvegicus)
IF(Mus musculus,Rattus norvegicus)

Western blot analysis of extracts of various cell lines, using Mitofusin 2 antibody (A19678) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Mitofusin 2 (O95140). Isotype IgG







