быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MLKL Rabbit mAb (A19685)
- Описание
- Характеристики
-
Overview
Product name MLKL Rabbit mAb Catalog No. A19685 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0165 Background
This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. Inhibitor studies and knockdown of this gene inhibited TNF-induced necrosis. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Alternatively spliced transcript variants have been described for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 373-471 of human MLKL (Q8NB16). Sequence STAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK Gene ID Swiss Prot Synonyms hMLKL Calculated MW 54kDa Observed MW 54kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, HeLa Cellular location Cell membrane, Cytoplasm Customer validation WB(Gallus gallus, Mus musculus, Rattus norvegicus)
ICH(Mus musculus)
IF(Mus musculus)
ELISA(Mus musculus)
IHC(Mus musculus)

Western blot analysis of extracts of various cell lines, using MLKL antibody (A19685) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 373-471 of human MLKL (Q8NB16). Isotype IgG







