быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Hex Rabbit mAb (A19689)
- Описание
- Характеристики
-
Overview
Product name Hex Rabbit mAb Catalog No. A19689 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2232 Background
This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hex (Q03014). Sequence TLPSPNSSFTSLVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTI Gene ID Swiss Prot Synonyms HEX; PRH; HMPH; PRHX; HOX11L-PEN Calculated MW 30kDa Observed MW 30kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of HepG2 cells, using Hex Rabbit mAb (A19689) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hex (Q03014). Isotype IgG