быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MNX1/HB9/HLXB9 Rabbit mAb (A19690)
- Описание
- Характеристики
-
Overview
Product name MNX1/HB9/HLXB9 Rabbit mAb Catalog No. A19690 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2233 Background
This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MNX1/HB9/HLXB9 (P50219). Sequence SQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD Gene ID Swiss Prot Synonyms HB9; HLXB9; SCRA1; HOXHB9 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, BxPC-3, Raji, Mouse pancreas Cellular location Cytosol, Nucleolus, Nucleoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using MNX1/MNX1/HB9/HLXB9 Rabbit mAb (A19690) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MNX1/HB9/HLXB9 (P50219). Isotype IgG