быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ENT2/SLC29A2 Rabbit mAb (A19691)
- Описание
- Характеристики
-
Overview
Product name ENT2/SLC29A2 Rabbit mAb Catalog No. A19691 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2234 Background
The uptake of nucleosides by transporters, such as SLC29A2, is essential for nucleotide synthesis by salvage pathways in cells that lack de novo biosynthetic pathways. Nucleoside transport also plays a key role in the regulation of many physiologic processes through its effect on adenosine concentration at the cell surface (Griffiths et al., 1997 [PubMed 9396714]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2/SLC29A2 (Q14542). Sequence MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL Gene ID Swiss Prot Synonyms ENT2; DER12; HNP36 Calculated MW 50kDa Observed MW Applications
Reactivity Human, Mouse, Rat Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location basolateral plasma membrane, nuclear membrane, nucleolus, plasma membrane 
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using ENT2/SLC29A2 Rabbit mAb (A19691) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using ENT2/SLC29A2 Rabbit mAb (A19691) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using ENT2/SLC29A2 Rabbit mAb (A19691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using ENT2/SLC29A2 Rabbit mAb (A19691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using ENT2/SLC29A2 Rabbit mAb (A19691) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2/SLC29A2 (Q14542). Isotype IgG