быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIM1 Rabbit mAb (A19695)
- Описание
- Характеристики
-
Overview
Product name PIM1 Rabbit mAb Catalog No. A19695 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0175 Background
The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons (PMIDs:16186805, 1825810).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIM1 (P11309). Sequence MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF Gene ID Swiss Prot Synonyms PIM Calculated MW 36kDa Observed MW 32kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 22Rv1 Cellular location Cell membrane, Cytoplasm, Nucleus 
Western blot analysis of extracts of 22Rv1 cells, using PIM1 antibody (A19695) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry of paraffin-embedded human cervix using PIM1 Rabbit mAb (A19695) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human liver using PIM1 Rabbit mAb (A19695) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse brain using PIM1 Rabbit mAb (A19695) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat brain using PIM1 Rabbit mAb (A19695) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIM1 (P11309). Isotype IgG