быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Hippocalcin (HPCA) Rabbit mAb (A19696)
- Описание
- Характеристики
-
Overview
Product name Hippocalcin (HPCA) Rabbit mAb Catalog No. A19696 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2235 Background
The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074). Sequence MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQK Gene ID Swiss Prot Synonyms BDR2; DYT2 Calculated MW 22kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples PC-12, MCF7, C6, Mouse testis, Rat brain Cellular location axon, cytoplasm, cytosol, dendrite cytoplasm, dendrite membrane, dendritic spine head, glutamatergic synapse, perikaryon 
Western blot analysis of extracts of various cell lines, using Hippocalcin (HPCA) (HPCA) Rabbit mAb (A19696) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Hippocalcin (HPCA) (P84074). Isotype IgG