быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Progesterone Receptor Rabbit mAb (A19697)
- Описание
- Характеристики
-
Overview
Product name Progesterone Receptor Rabbit mAb Catalog No. A19697 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51400 Background
This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3). Sequence AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD Gene ID Swiss Prot Synonyms PR; NR3C3 Calculated MW 99kd(CST:90, 118KD) Observed MW 90kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples T-47D Cellular location Cytoplasm, Cytoplasm, Mitochondrion outer membrane, Nucleus Customer validation WB(Mus musculus)
Western blot analysis of extracts of BT-474 cells, using Progesterone Receptor antibody (A19697) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human breast using Progesterone Receptor Rabbit mAb (A19697) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human breast cancer using Progesterone Receptor Rabbit mAb (A19697) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3). KO Validated Validated Isotype IgG