быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
IGHD Rabbit mAb (A19708)
- Описание
- Характеристики
-
Overview
Product name IGHD Rabbit mAb Catalog No. A19708 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2240 Background
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in positive regulation of interleukin-1 production. Located in blood microparticle and extracellular exosome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880). Sequence APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRRDSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRW Gene ID Swiss Prot Synonyms Calculated MW 42kDa Observed MW 55kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Human plasma Cellular location blood microparticle, external side of plasma membrane, extracellular exosome, extracellular space, immunoglobulin complex, circulating, plasma membrane 
Western blot analysis of extracts of Human plasma, using IGHD Rabbit mAb (A19708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human Hodgkin lymphoma using IGHD antibody (A19708) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IGHD (P01880). KO Validated Validated Isotype IgG