быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Human IgG3 Rabbit mAb (A19713)
- Описание
- Характеристики
-
Overview
Product name Human IgG3 Rabbit mAb Catalog No. A19713 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2243 Background
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Involved in retina homeostasis. Located in blood microparticle and extracellular exosome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860). Sequence VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSC Gene ID Swiss Prot Synonyms IgG3 Calculated MW 41kDa Observed MW 60kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples human plasma Cellular location Blood microparticle, External side of plasma membrane, Extracellular exosome, Extracellular region, Extracellular space, Immunoglobulin complex, Circulating 
Western blot analysis of extracts of human plasma, using Human IgG3 antibody (A19713) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IgG3 (P01860). Isotype IgG