быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Mammaglobin A Rabbit mAb (A19727)
- Описание
- Характеристики
-
Overview
Product name Mammaglobin A Rabbit mAb Catalog No. A19727 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2255 Background
Predicted to be involved in androgen receptor signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296). Sequence MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Gene ID Swiss Prot Synonyms MGB1; UGB2; PSBP1 Calculated MW 10kDa Observed MW 10kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples BT-474 cells Cellular location Cytoplasm, extracellular space 
Western blot analysis of extracts of BT-474 cells, using Mammaglobin A Rabbit mAb (A19727) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded human breast cancer using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human breast using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human skin using Mammaglobin A Rabbit mAb (A19727) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296). KO Validated Validated Isotype IgG