быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PLC beta 3 (PLCB3) Rabbit mAb (A19738)
- Описание
- Характеристики
-
Overview
Product name PLC beta 3 (PLCB3) Rabbit mAb Catalog No. A19738 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2269 Background
This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1, 4, 5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970). Sequence RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG Gene ID Swiss Prot Synonyms SMDCD Calculated MW 139kDa Observed MW 150kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, OVCAR3 Cellular location Cytosol, Nucleus, Postsynaptic cytosol 
Western blot analysis of extracts of various cell lines, using PLC beta 3 (PLC beta 3 (PLCB3)) Rabbit mAb (A19738) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970). Isotype IgG