быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MEKK2 Rabbit mAb (A19739)
- Описание
- Характеристики
-
Overview
Product name MEKK2 Rabbit mAb Catalog No. A19739 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2291 Background
The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5). Sequence MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLD Gene ID Swiss Prot Synonyms MEKK2; MEKK2B Calculated MW 70kDa Observed MW 78kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples MCF7, Jurkat, Mouse lung Cellular location cytoplasm, cytosol, nucleoplasm 
Western blot analysis of extracts of various cell lines, using MEKK2 Rabbit mAb (A19739) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded rat kidney using MEKK2 Rabbit mAb (A19739) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using MEKK2 Rabbit mAb (A19739) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEKK2 (Q9Y2U5). Isotype IgG