быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PAX9 Rabbit mAb (A19741)
- Описание
- Характеристики
-
Overview
Product name PAX9 Rabbit mAb Catalog No. A19741 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2267 Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. Mice lacking this gene exhibit impaired development of organs, musculature and the skeleton, including absent and abnormally developed teeth, and neonatal lethality. Mutations in the human gene are associated with selective tooth agenesis-3.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX9 (P55771). Sequence MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAW Gene ID Swiss Prot Synonyms STHAG3 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples PC-3, Mouse stomach, Mouse thymus, Rat lung, Rat stomach Cellular location nucleolus, nucleoplasm 
Western blot analysis of extracts of various cell lines, using PAX9 Rabbit mAb (A19741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using PAX9 Rabbit mAb (A19741) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PAX9 (P55771). Isotype IgG