быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PI3 Kinase p110 delta Rabbit mAb (A19742)
- Описание
- Характеристики
-
Overview
Product name PI3 Kinase p110 delta Rabbit mAb Catalog No. A19742 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2268 Background
Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I PI3K found primarily in leukocytes. Like other class I PI3Ks (p110-alpha p110-beta, and p110-gamma), the encoded protein binds p85 adapter proteins and GTP-bound RAS. However, unlike the other class I PI3Ks, this protein phosphorylates itself, not p85 protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI3 Kinase p110 delta (O00329). Sequence EESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR Gene ID Swiss Prot Synonyms APDS; PI3K; IMD14; p110D; IMD14A; IMD14B; ROCHIS; P110DELTA Calculated MW 119kDa Observed MW 119kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse thymus Cellular location cytoplasm, cytosol, plasma membrane Customer validation WB(Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus)
WB;IP(Homo sapiens)
IHC(Homo sapiens)
IF(Homo sapiens)
Western blot analysis of extracts of Mouse thymus, using PI3 Kinase p110 delta Rabbit mAb (A19742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat spleen using PI3 Kinase p110 delta Rabbit mAb (A19742) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PI3 Kinase p110 delta (O00329). Isotype IgG