- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name PRKAR2B Rabbit mAb Catalog No. A19745 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2272 Background
cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323). Sequence GEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA Gene ID Swiss Prot Synonyms PRKAR2; RII-BETA Calculated MW 46kDa Observed MW 46kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brian, Rat brain Cellular location Cytoplasm, Cell membrane 
Western blot analysis of extracts of various cell lines, using PRKAR2B Rabbit mAb (A19745) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse brain using PRKAR2B Rabbit mAb (A19745) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat ovary using PRKAR2B Rabbit mAb (A19745) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 319-418 of human PRKAR2B (P31323). Isotype IgG







