быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRK2/PKN2 Rabbit mAb (A19746)
- Описание
- Характеристики
-
Overview
Product name PRK2/PKN2 Rabbit mAb Catalog No. A19746 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2274 Background
Enables RNA polymerase binding activity; histone deacetylase binding activity; and protein serine/threonine kinase activity. Involved in several processes, including apical junction assembly; positive regulation of cell cycle; and positive regulation of viral genome replication. Located in several cellular components, including cleavage furrow; cytoskeleton; and midbody.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513). Sequence MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL Gene ID Swiss Prot Synonyms PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042 Calculated MW 112kDa Observed MW 112kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, NIH/3T3, Jurkat, C6 Cellular location Apical junction complex, Centrosome, Cytoplasm, Cytosol, Intermediate filament cytoskeleton, Nuclear body, Nucleoplasm, Nucleus, Perinuclear region of cytoplasm, Plasma membrane 
Western blot analysis of extracts of various cell lines, using PRK2/PRK2/PKN2 Rabbit mAb (A19746) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513). Isotype IgG